McDonnell Genome Institute

Washington University

CircRNA

chr1|12356397|12460396|+|VPS13D|ENST00000011700.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9012

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

VATDLQTGQCQDR

Amino Acids from 5' Exons

GCHSSDRTMPRQMLQASLRSMSWPVAVLSYSAMLTKSSQT,VATDLQTGQCQDRCCRPVGAAGPPESSLILLCQRAAKP,LPLIFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKEQPN

Amino Acids from 3' Exons

VSLVDPVLLRQWKVKQKGVSAVSYLALEKGLLALPSQWQAPWILHQKQPRRETQPHSAAP,YHWWTDQCYNFDSGRCENRRGCQRFHIWPWKRACWHCNQASGRRPGFCIRNSPGGERHSHTQRPQ,IIGGLTSVITSTVEGVKTEGGVSGFISGLGKGLVGTVTKPVAGALDFASETAQAVRDTATLSGP