McDonnell Genome Institute

Washington University

CircRNA

chr1|12322535|12333366|+|VPS13D|ENST00000011700.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9088

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LIQLQALDIR

Amino Acids from 5' Exons

IQLQALDIRLSYNDVQLFLAIAKSIPEQANAAVPDSVALESDSVGTYLPGASRVGEEIREGTRHTLDPVL,FSYKPWISDSPIMMFSCFLPLQNPSQSKLMLQCQTQWPWSQTPLALTFQVHLALERKSEKGQDTPILSW,SVTSPGYQTLLCSAVSCHCKIHPRASCCSARLSGPGVRLRWHLPSRCISRWRGNQRRDKTHLRSCL

Amino Acids from 3' Exons

AGSHLLSLGHALYPGNSRQLVVSILLDSKPRPNLVWISISLLCL,LGAIYALAMLCILATAGSSSPSSSTEARSQGQTSFGYQYHFCAN,WEPFIEPWPCSVSWQQQAASRLHPPRLKLEAKAKPRLDINITSVLI