McDonnell Genome Institute

Washington University

CircRNA

chr1|12299201|12304728|+|VPS13D|ENST00000011700.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9352

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

NPHCLLAK

Amino Acids from 5' Exons

VRDQAQRCSRVLLDIEAGAPVLLIPESSRSNNLIVANLGKLKVKNKFLFAGFPGTFSLQDK,EIKPSAVHGFSWILRLVLPFSSQKVPDQIILQIWGSKSKISFCLLVFLAPFPYKI,ERSSPALFTGSPGYGWCSRSLDPRKFQIKSDCSKFGEVESQKVSVCWFSWHLFPTR

Amino Acids from 3' Exons

ESVPSASPTGIPKHSLRKTTSTEEPRGTHSQGQFTMPLAGMSLGSLKSEFVPSTSTKQQGPQPTLSVGQESSSP,NLCLQLPQRVFPNTVGKRQARRSPGEPIPRGSSRCLLLEAEARVSLCPVPPPSSKGRNPHCLLAKSPVVQ,ICAFSFPNGYSQTQSEENDKHGGAQGNPFPGAVHDASCWNEPRKPEEVCAQYLHQAARAATHTVCWPRVQS