McDonnell Genome Institute

Washington University

CircRNA

chr1|12275824|12279650|+|VPS13D|ENST00000613099.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9636

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

FVNPVQITPGGK

Amino Acids from 5' Exons

ITPGGKVGMGQHLKRPSLVMMNIRPPWPHLLTPHLPSQAAATERKHLPFLELSSVKNSFKHIAQRCMRGTRCHLWTSRSWLDEKTIGSMSRILTWDQHMWRSSTFTYSSVDFILQIPNIQEPCSQATYQTKSTLMKIKYLHRIALLSSPPQKKLLTLRLKKRFFPRRSSGEVCKTPIPRALCCWSSIPARFWWSRSSSWRNLKTVCSLVLRAMAGTFLCSRCLVPMLTLRGLMMLKSPLFMVCSWWIPCRHMVLILTFWLHIRTALIFQREAFGIAGPSLLSLDRMWPTLMELHTTDQLLVFHLTKFLPKSKSPLLSWNISLVQSAHRITVLFRFPYRIIILSSIQRRLWSLVFFKNPFPRKKMIVLNLLILKEASENKELTSLHMNKTLRLQWKSIGTYCFFGQWAWQIERNMAEKLQLQVVAPKLMSQWVARLTMVLLAVYSLWIHKITLKTSMLSALGILAMKISSVILATLNLCLSEWKMQPSLKLVSRLLRDLNRSVFSTRWLLYIITTLLSFRSRYPWMNWKKIFEVCKAQPPKSPQYLPRLPSIARWYRSLKLQGRLGNPLSRKMKYMGLTLRLIWTLSSTTLNHQLFLSLGSRGVLSCWWDTWDRYSSRILWREMMNPEVTVCRWKSRTLNCILIAPSWQVEKLLGLKEAGCFAHLPGLAVPTVRRKLISHDMISLNLCIEVK,LQEEKGWVSIRDPVIDPPGHTSHPTSRVKQQQRRENTSLFWSVQRTASSTFNEHKDVEVLAVIYGPPDHGWTSERQLEACPGYRGTNTCGREVQRSPTVRASIDLYFRSQISRSRALRQLTRLKNPHRNICTKELLCSPHHPRNENFHSDRKDFSPGGAAGKFARLRNEFNPEHCVVGAAYPRGSGGVAAPPGGISELYAAWCEQWPVHFCAQGVWYQCSLCEEALCSLPNCSWFAPGGYHADIWCFPFDGFTELELYSNGKPSGQGPVSCLWTECGPLNWSYTERPISYCFTQNSYQRARVPYVGISVCEFRVPIDEFRQYSSGDFPTGEFRYYPQSRDDCGANWFSSKILSQGKRFKSSTFNDFKKLQRTRNLPVYITKHGCSGNPAELTASSDSGHGKREIWQKNCNCKYRWHQSCLNGHVHEWFSWLFTAYGFDTRRKPVCCQHWEFCRLKYHQYWLLICVCQNGRCSPHSFEFHVCEITGVFSQPEDGFFTLPLCVFEGVDVIHGTGRKFSRYAEKRSHQSHHSTSYQDCRVRDGIALNSKEDSGTLYLRGKNIWVPSFVSFGHCKANLEHKHITSCFYPSEAGESVVGGTLGTDIHPEFCGGRIQKPSAGGNQGHTVFFELHPVGRRSCWVRKPDVLPTFRVWQCQQSGGSSFHTTFLIFARS,NSRRKSRDGSASEETQFSDDEYKTPLATPPNTPPPESSSSNGEKTPPFSGVEFSEEQLQAHLMSTKMYERYSLSFMDLQIMVGRVKDNWKHVQDIDVGPTHVVEKFNVHLQLERRLIYTSDPKYPGAVLSGNLPDLKIHINEDKISALKNCFALLTTPEMKTSDTQIKEKIFPQEEQRGSLQDSVMNLTQSIVLLEQHTREVLVESQLLLAEFKVNCMQLGVESNGRYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTMQTYGADFDLLMASHKNLSFDIPTGSLRDSRAQSPVSGPNVAHLTDGATLNDRSATSVSLDKILTKEQESLIKLEYQFVSSECPSMNLDSTLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKDDLSPQPLMTDFERSFREQGTYQSTYEQNTEVAVEIHRLNLLLLRTVGMANREKYGRKIATASIGGTKVNVSMGSTFDMNGSLGCLQLMDLTQDNVKNQYVVSIGNSVGYENIISDIGYFESVFVRMEDAALTEALSFTFVERSKQECFLNLKMASLHYNHSAKFLKELTLSMDELEENFRGMLKSAATKVTTVLATKTAEYSEMVSLFETPRKTREPFILEENEIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGSPELLVGHLGQIFIQNFVAGDDESRSDRLQVEIKDIKLYSLNCTQLAGREAVGSEGSRMFCPPSGSGSANSQEEAHFTRHDFFESLHRGQ

Amino Acids from 3' Exons

LFTSTTPPFSLNWRRSLRENLNLFLLAQMTWELLASRLKENLSIQF,FSHPEQHHHSVTGEDPYRERIIDFFSPRPGNFHHEDRKICQSSS,FHILNNTTIQFKLEKIPIERESELTFSLSPDDLGTSSIMKIEGKFVNPVQ