McDonnell Genome Institute

Washington University

CircRNA

chr1|12244245|12253826|+|VPS13D|ENST00000613099.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.903

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

13

Peptide

LHFTGGFASDGVTGFIGK

Amino Acids from 5' Exons

ASLGKPFRFPFIAPMWTLGSPSPAFTLEPQRKYRISMMKRRSCWKGNVRKHYFKPWRRNG,LHWESNPSDSLLSPPCGPLGDLHLQPSLNWSPRENTGFQKGEAVGKGTESTTSSPGGEME,FIGKVTLQIPFYRPHVDPWVISISSLHLIGAPEKIQDFNDEKEKLLERERKKALLQALEEKWK

Amino Acids from 3' Exons

VQKLMRKKQLDVAEFSIYWDVDCTLLGDLPQMELQ,YRNCGKSNTQNLASIGMSIALYWGICLRWSY,TETNAEKAIRRSRIHLLGCRLHFTGGFASDGVT