McDonnell Genome Institute

Washington University

CircRNA

chr1|11947975|11950520|+|PLOD1|ENST00000196061.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9354

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

5

Peptide

FLGSGDNLLVLTVATK

Amino Acids from 5' Exons

TTFSSRWPLRRPRDSVASSAQLSSSTTRS,QPFSPHGGHGDRGIPSLQALSSVLQLQDP,NLLVLTVATKETEGFRRFKRSAQFFNYKIQ

Amino Acids from 3' Exons

LRAVCIGAPGAPEEVPAGQEPGGLLCGAHLPRPQAGDQVSGGVRWQEVPGLW,YDVLFASGPRELLKKFRQARSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSG,MTCCLHRGPGSSRSSGRPGARWSSLLRSSSTQTAGWRPSIRWCPMARGSWALE