McDonnell Genome Institute

Washington University

CircRNA

chr1|117948404|117952408|+|WDR3|ENST00000349139.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9934

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

FEHIQTLETGK

Amino Acids from 5' Exons

TGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQ,QGSCSFMTWLQGICWRQMHMMELCGPCPSLQI,REAAALLGFRESAGDNRCTWSFVVHVPLSRS

Amino Acids from 3' Exons

CDVPTVCTQVSPLLHCRKRSDTVGCRQITHTDSG,VMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLE,CTYSLYPSLTSSSLPEKIIRLNSGMQTNLNTYRLW