McDonnell Genome Institute

Washington University

CircRNA

chr1|11793906|11796399|-|MTHFR|ENST00000376583.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9558

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

VTPKATPK

Amino Acids from 5' Exons

VTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQK,LACPGTMSPWRLRPACRRSCCGTARASSPSTHSPTSTGSRPPTPSWAGAPAGAMSSR,DLPALERAPGGDQPAEGGAAAGEPPGHPHHQLTAQHQREAVLRPHRGLGPQRGLCLPE

Amino Acids from 3' Exons

VTPKATPKQGALRLTSTRRRCLREPISSSRSFSLRLTHSSALRHAPTWASLAPSSPGSFPS,LPQRPPRSRELGPEALEGEGVCGSRFHHHAAFLGHILPLCEGMHRHGHHLPHRPRDLSHP,YPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQ