McDonnell Genome Institute

Washington University

CircRNA

chr1|117911993|117918736|-|GDAP2|ENST00000369442.3

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9569

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

GCNTHSTSK

Amino Acids from 5' Exons

RAVNVFCWLLCHQFCKTWLSFRGCNTHST,EQSMSSVGFCVINSAKRGYPLEDATHIAL,SSQCLLLASVSSILQNVVILRMQHTHF

Amino Acids from 3' Exons

ERRCGITELYSHCEYQQKSHRESCVRKYLHACRAFEGRSPET,KGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLK,KEMWHYTVQPLIPAMKVSQIRILCQKVSSCLQGLIRKISRNLK