McDonnell Genome Institute

Washington University

CircRNA

chr1|117147612|117153369|-|VTCN1|ENST00000328189.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9113

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LGTSASQPLPDAK

Amino Acids from 5' Exons

NRRSKGGVTYSCTQRLLCVSLLSLPSAGHFCLSALTCNNVPRPQKSMQSHCYN,IGDQKAESPTAAKLKGFSVCLFFLCHQLGTSASQPLPDAKIMCLGHKKACKVIVTT,SEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLKCASATKKHAKSLLQQ

Amino Acids from 3' Exons

PSACRKMWTIMPAQRPCGVRLPDGSPSPQWSGHPKLTREPTSRKSPIPALSTLRMPRLCLCSTMLRSTTHTPVLKMTLPKQQGISKQ,LQHAGSECGLCQLRDLAVGSPMVPPAHSGLGIPSPGSQLLGSLQYQLAELECDHEGCVCALQCYDQQHILLYDKHCQSNRGYQSD,FSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVT