McDonnell Genome Institute

Washington University

CircRNA

chr1|117077915|117092901|+|TTF2|ENST00000369466.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9739

79

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

ITFMQCGK

Amino Acids from 5' Exons

AIQTKITFMQCGKSQVKPSVNCIAHLSHVLVRRLWQKIPPG,PYKPRSRSCSVENHKSHRSTASLTVMSWDGCGRRSRRAE,HTNQDHVHAVWKITSEAIGQLHRSLESCPGETVVAEDPAGLK

Amino Acids from 3' Exons

ALDPMELKGEGLVLSLEEQLSALTLSELRDSEPSSTVSLNGTFFKMELFEGMRESTK,PWIQWNRVKVLSFPWKNSSVLPCQNSVTQSHLPLFPLTAPSSRWSFLKACERAP,PGSNGTEGRSCPFPGRTAQCFDLVRTPLRAIFHCFPRHLLQDGAFRHAREHQ