McDonnell Genome Institute

Washington University

CircRNA

chr1|11658266|11658871|+|FBXO44|ENST00000251546.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

ASGDLPARPGDHPAEER

Amino Acids from 5' Exons

RGSSSGAWMMEAMSGRWRISLETRGRNSPMT,GVRVLEPGCEWRRVEGGGSLSRPEEGIPQP,GFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQ

Amino Acids from 3' Exons

VRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEG,FAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWRE,SQPGQIAGPSTSCAFSSCRPRTRLWGPSSQTRRPSSRRAMPSGG