McDonnell Genome Institute

Washington University

CircRNA

chr1|11500989|11502897|+|PTCHD2|ENST00000294484.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9981

55

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

AHSQSER

Amino Acids from 5' Exons

TMDTEDDPLLQDVWLEEEQEEEEATGETFLGAQKPGPQPGAGGQCCWRHWPLASRPPASGFWSTLGWAFTNPCCAGLVLFLGCSIPMALSAFMFLYYPPLDIDISYNAFEIRNHEASQRFDALTLALKSQFGSWGRNRRDLADFTSETLQRLISEQLQQLHLGNRSRQASRAPRVIPAASLGGPGPYRDTSAAQKPTANRSGRLRRETPPLEDLAANQSEDPRNQRLSKNGRYQPSIPPHAAVAANQSRARRGASRWDYSRAYVSANTQTHAHWRIELIFLARGDAERNIFTSERLVTIHEIERKIMDHPGFREFCWKPHEVLKDLPLGSYSYCSPPSSLMTYFFPTERGGKIYYDGMGQDLADIR,LWTRRMTPCCRMCGRRSRRRKKQRVKPFGPRSQGPNLGQGDSVAGGTGPWLPDPQLRASGVPWAGPSPIRAVLGWCSSWAAASPWPCQPSCSFTTHRWTLTSPTTPLRSATTRPHSVSTLSLWRLSPSLDPGGGTGAIWPTSPPRRFSALSQSSCSSCISATARGKPPEPPASSPRPHSVAQALTGTLPRLKSPQPIGAGDFGVRPRPWRIWQPTRVKTRETSGARMGGTSPASRPTRQSRPIRAVPAEAPRAGTTRAPMVPTLRRTRTGASSSSSWRAATRSATFSPVSAWSRSMRSSARSWTTQASGSSAGSPTRCSRICRWAPTPTARPPARSPTFFPPRGAARSTMTAWARTWRTSG,YGHGGPLAAGCVARGGAGGGRSNGNLFRGPEARAPTWGRGTVLLAALAPGFPTPSFGLLEYPGLGLHQSVLCWAGALPGLQHPHGPVSLHVPLLPTAGHHLLQRLDPQPRGLTAFRRSHSGAVPVWILGAEPARFGRLHLRDASAPYLRAAAAAASRQPLAASLPSPPRHPRGLTRWPRPLPGHFRGSKAHSQSERATSADPAPGGSGSQPERPAKPAAEQEWAVPAQHPAPRGSRGQSEPCPPRRLALGLLARLCECQHSDARALAHRAHLPGARRRGAQHFHQAPGHDPDRAQDHGPPRLPGVLLEAPRGAQGSAAGLLLLLLAPQLAHDLLFSHREGRQDLLRHGPGPGGHP

Amino Acids from 3' Exons

APWSWPLTLSSTGMWMRASLQTIRAPSCAVRSCLEHPCPTTTQMTAGRNNGLSFRASWSPTWPCWPSSLP,LPGAGHDSPVLLVCGGPLCRQSEELPPAQDPVWSTPAQLLLSRPLGGTTGVSELRGHLRGHAGQAVYQ,SLELAMTHPEFYWYVDEGLSADNLKSSLLRSEILFGAPLPNYYSVDDRWEEQRAKFQSFVVTYVAMLAKQST