McDonnell Genome Institute

Washington University

CircRNA

chr1|114720538|114732816|-|CSDE1|ENST00000261443.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9763

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

DQNDPLPGR

Amino Acids from 5' Exons

AIKVRSIHLASLGWPTKGIACRKGRASSSNCVSWAKMHKLWLTTSHPCAGPQWNVKI,RYERGLSIWHRWDGQQRGLPAERGERQVPIVCPGPKCTNYGLQHHTPAQGHSGMCERS,DMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQ

Amino Acids from 3' Exons

NDPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREM,MTHCQDASKLTLSLKNFPLETKIRNPRPCWKVTMLGLIFQQTDVTNSEQPIKFCQIHFSSLMKPEK,PIARTHQSLCDPRTSLWRQRYEIQGDPAGRPCVYFNRPTQIRASNQYRSSVKYISVHSPRN