McDonnell Genome Institute

Washington University

CircRNA

chr1|113954625|113968648|+|HIPK1|ENST00000369553.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9449

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

YKPSSCLMVLMFQIR

Amino Acids from 5' Exons

LFDGFDVSDSLYFTNTRLASISSQCRNKNNQVFQQRSFGVPTVEA,CLMVLMFQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLK,VWFCFRFVIFHKHKACQLNIFSVPEQKQPGFSTEILIWGTHCGGL

Amino Acids from 3' Exons

VLSRCSAFPSLFSGWEQSPPHHIFLFLGPCPRSASAHHHSRYSQPSCECHHYPKHGRGQQIQAQ,SSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPS,PLMFCLPKSILWLGAVPSAPHLLIIPWSLSKISISPSSFQILPALLVSSLSEVTLMRKRTTNTSPV