McDonnell Genome Institute

Washington University

CircRNA

chr1|113797362|113798036|-|RSBN1|ENST00000261441.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9827

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

DIETTTISNFHTQK

Amino Acids from 5' Exons

KHQMKMVKPREPMILSRKRRKRKRNTEKTCEEDALKCTIRKYKPSVLAPASVKKFSPKDKIALQDLIRSPSGIKMNSCADIWVCKNIGYPREYKHLLLTRNILFVEISKQVLNLATLFMRNTSPMVVLLSFMLTWMNSHFCLQWRWRDFLRSFLLHSVKMRKMLLTMLQCMERLLISQTSWTTLLLISPTLQKWKFWARKILKQPPFQIFTL,NTRKWNPESRFCLEENKEEKEKETPRRHARKTPNVQGSTNRLCWPDPHQRNSHPRTNKHFRTGVLQVSERTAVPIKFGYARISGTPGSTNTFYDSPGTFYSKFLKNRYIQLYSGTPVQWWCSCPSCLHGTLIFVSNGDGEIFGVSCFDIQKEKCCLLCFSNSAWSGCLSPRLLGLLCFFPQHSSENGNSGQERYNNHHFKFSHS,TPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ

Amino Acids from 3' Exons

KHQMKMVKPREPMILSRKRRKRKRNTEKTCEEDALKCTIRKYKPSVLAPASVKKFSPKDKIALQDLIRSPSGIKMNSCADIWVCKNIGYPREYKHLLLTRNILFVEISKQVLNLATLFMRNTSPMVVLLSFMLTWMNSHFCLQWRWRDFLRSFLLHSVKMRKMLLTMLQCMERLLISQTSWTTLLLISPTLQKWKFWARKILKQPPFQIFTL,NTRKWNPESRFCLEENKEEKEKETPRRHARKTPNVQGSTNRLCWPDPHQRNSHPRTNKHFRTGVLQVSERTAVPIKFGYARISGTPGSTNTFYDSPGTFYSKFLKNRYIQLYSGTPVQWWCSCPSCLHGTLIFVSNGDGEIFGVSCFDIQKEKCCLLCFSNSAWSGCLSPRLLGLLCFFPQHSSENGNSGQERYNNHHFKFSHS,TPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ