McDonnell Genome Institute

Washington University

CircRNA

chr1|113796185|113798036|-|RSBN1|ENST00000476412.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9615

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

7

Peptide

LALLPQPETPDENGK

Amino Acids from 5' Exons

REQEQPMWRGRKMGLPKMLEHHVQRASSWILALLPQP,RESRSSQCGEVARWGCPRCWNTMCNKGLRLGFWPYYHNQ,ERAGAANVERSQDGAAQDVGTPCAIKGFVLDFGLITTT

Amino Acids from 3' Exons

KHQMKMVKPREPMILSRKRRKRKRNTEKTCEEDALKCTIRKYKPSVLAPASVKKFSPKDKIALQDLIRSPSGIKMNSCADIWVCKNIGYPREYKHLLLTRNILFVEISKQVLNLATLFMRNTSPMVVLLSFMLTWMNSHFCLQWRWRDFLRSFLLHSVKMRKMLLTMLQCMERLLISQTSWTTLLLISPTLQKWKFWARKILKQPPFQIFTL,NTRKWNPESRFCLEENKEEKEKETPRRHARKTPNVQGSTNRLCWPDPHQRNSHPRTNKHFRTGVLQVSERTAVPIKFGYARISGTPGSTNTFYDSPGTFYSKFLKNRYIQLYSGTPVQWWCSCPSCLHGTLIFVSNGDGEIFGVSCFDIQKEKCCLLCFSNSAWSGCLSPRLLGLLCFFPQHSSENGNSGQERYNNHHFKFSHS,TPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ