McDonnell Genome Institute

Washington University

CircRNA

chr1|113112478|113116436|+|LRIG2|ENST00000361127.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9734

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

GTDEMPSFLK

Amino Acids from 5' Exons

RCHLFKRQWILFALVPWPDNVLQRDTLHLRFPGRKMVVLTFLRLEKDACTSCPRMTSSLLPMKKIWESIAAWHKIQQEVSQQMLPQC,DAIFSENANGSDYSHWCHGQIRMCCRGTPCTSDFLAERWWYLSCGSRKTHARHARGRLLYCQCENRRYGNLLHGTKYSRRSLSKCFPNSV,MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTVL

Amino Acids from 3' Exons

RSSICLQTFPATCLPKERCLSHRKATATLRQAVISNLCLLPMDIYTKALT,GAQSACRHSQLLVFPRNAVATGRLQQLGRQSSATYASCQWIYTQRH,ELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTD