McDonnell Genome Institute

Washington University

CircRNA

chr1|112691664|112694172|+|MOV10|ENST00000357443.2

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9611

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LSFSMSAK

Amino Acids from 5' Exons

RGLPGVKYGAGDILPTSPPQAAAPHASSGNKYLHCPGDRRDQ,AKGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEI,LRAMTWSVWRWGHTTHLPASGSCSPCFFREQVSSLPLRRSQRS

Amino Acids from 3' Exons

VPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSM,FLELRAAPQCYGATTCLPFCPRRHTRRTPSHIRALCTRWNWTVSSAFP,SWSDEPPLSATGRPPVCPFVLGDTPGGPHHIGLCAQGGIGPCQAELFHE