McDonnell Genome Institute

Washington University

CircRNA

chr1|11228667|11231434|-|MTOR|ENST00000361445.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

21

Peptide

EVALWTLGQLVASTGYVVEPYR

Amino Acids from 5' Exons

LTIALVKCWSTWETCLWMSSTQLCPWWPCGSSETSHSLIITPWLSRPSPSSSSPWDSNVCSSCPRSCPRSLTSFESVMGPSG,LHNAGQHGKLASGVLPSCVHGGPDADLPRPVTLSSSHHGCPGHHLHLQVPGTQMCAVPAPGHAHVPRHSSLWGHPG,DYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIRE

Amino Acids from 3' Exons

VALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRRE,WLCGPWDSWWPALAMSPTGSTLLCLRCYIFRLSRTRVHAE,GSVDPGTVGGQHWLCSRALQEVPYFAGATEFSEDAEPGYTQR