McDonnell Genome Institute

Washington University

CircRNA

chr1|111981620|111982798|-|KCND3|ENST00000302127.4

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

AQLLPHGEAALPALR

Amino Acids from 5' Exons

GLLNLQAGVPSVRAAAGPRAGVTMAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTL,VCTNSKLVCLASARLPAQELESPWRPELRPGCLLPGLRPSGGCRWPTAPCPWPRPTRTSGRMSLSSTVGGGSRPGGPRWSATRTPCWAARRRSSSSTRTPRSTSSTGTPRCSAACSTSTARGSCTTRATSASLPTTTSWPSTASSRRSSGTAATRSTRTARGRTPSGSWTTTTRRTTRSPCPRSASARPCGGPSRTPTPARWPWSSTTLASSSLSRSSPTWWRRCRAARSRAARSCRAGSATRWPSSAWTRRASSSPWSTSCGSSRLPAATASSAASASSTWWPSCPTTSVWSPTTRTCPAPSSRSGSSASSGSSSFPATPRACGSWATHRAVPPNWAFFSSPSPWPSSSLPLCFMPRRAPRPASSQASLPRFGTPLSPPHW,FAELTPSWCARPRGCRPKSWSHHGGRSCGLAAFCPGCGHRVDAGGQLPHAPGPGRQEQAAGADCPQREWAEVPDLEDHAGALPGHPAGQHGEGVLLQRGHQGVLLRPGPRGVPLRAQLLPHGEAALPALRVHLCLRRRAGLLRHPPGDHRGLLLRGVQGPQEGERRAAHGRQRLGEQPGVHALAQLPPDHVAGLREPPHQHAGPGLLLRDWLLHRCLGHHQRGGDGAVRHGPGQQGAAVRGALLGGLLLPGHGVRHDLHRGVPPAALRGSQPLPLHPQRHEHHRRGGHHALLHRSGHDQQRGRVRRLRHAPGLPRLQDLQVFPPLPGPADPGLHTEELCLRTGLSSLLPHHGHHHLCHCDVLCREGLLGQQVHKHPCLVLVHHCHHDHTG

Amino Acids from 3' Exons

GLLNLQAGVPSVRAAAGPRAGVTMAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTL,VCTNSKLVCLASARLPAQELESPWRPELRPGCLLPGLRPSGGCRWPTAPCPWPRPTRTSGRMSLSSTVGGGSRPGGPRWSATRTPCWAARRRSSSSTRTPRSTSSTGTPRCSAACSTSTARGSCTTRATSASLPTTTSWPSTASSRRSSGTAATRSTRTARGRTPSGSWTTTTRRTTRSPCPRSASARPCGGPSRTPTPARWPWSSTTLASSSLSRSSPTWWRRCRAARSRAARSCRAGSATRWPSSAWTRRASSSPWSTSCGSSRLPAATASSAASASSTWWPSCPTTSVWSPTTRTCPAPSSRSGSSASSGSSSFPATPRACGSWATHRAVPPNWAFFSSPSPWPSSSLPLCFMPRRAPRPASSQASLPRFGTPLSPPHW,FAELTPSWCARPRGCRPKSWSHHGGRSCGLAAFCPGCGHRVDAGGQLPHAPGPGRQEQAAGADCPQREWAEVPDLEDHAGALPGHPAGQHGEGVLLQRGHQGVLLRPGPRGVPLRAQLLPHGEAALPALRVHLCLRRRAGLLRHPPGDHRGLLLRGVQGPQEGERRAAHGRQRLGEQPGVHALAQLPPDHVAGLREPPHQHAGPGLLLRDWLLHRCLGHHQRGGDGAVRHGPGQQGAAVRGALLGGLLLPGHGVRHDLHRGVPPAALRGSQPLPLHPQRHEHHRRGGHHALLHRSGHDQQRGRVRRLRHAPGLPRLQDLQVFPPLPGPADPGLHTEELCLRTGLSSLLPHHGHHHLCHCDVLCREGLLGQQVHKHPCLVLVHHCHHDHTG