McDonnell Genome Institute

Washington University

CircRNA

chr1|109228351|109231786|+|SARS|ENST00000234677.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9852

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

18

Peptide

EVMQEVAQLSQFDEELYKK

Amino Acids from 5' Exons

KKEPVGDDESVPENVLSFDDLTADALA,KKSQWEMMSLSQRMCVSMTLLQTL,KRASGRVCPRECAEFRPYCRRFS

Amino Acids from 3' Exons

GVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYK,GSWCSWNRLSSSMPFAPWEVGATFPFIPPFSGRRSCRRWHSSASLMKNFI,GPGVPGTGSHPVCPSHLGKSGLHSHLYPLFHEEGGHAGGGTAQPVRTL