McDonnell Genome Institute

Washington University

CircRNA

chr1|109161893|109173837|+|KIAA1324|ENST00000369939.7

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

APLSANFAQPTLIQIK

Amino Acids from 5' Exons

SEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPIKGTEC,LSTTMSTRRVTARVPGGGSPCRIPRACAPACLTPSRAPSA,VPLVHGVQHGFQVEGRRAAYPGPVHQPAPHQGHRV

Amino Acids from 3' Exons

GWPTLQNASPANLARMQTSRAPLSANFAQPTLIQIKEKLLATSVTLTNTQ,GGLHFRMLPLQTWHVCRQAGLLFLQTLPSQLLFKRRNFLPPVPQIL,VAYTSECFPCKPGTYADKQGSSFCKLCPANSYSNKGETSCHQCDPDKYS