McDonnell Genome Institute

Washington University

CircRNA

chr1|108995579|109004715|-|WDR47|ENST00000357672.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

NHLVEAK

Amino Acids from 5' Exons

VHSKAWIKYWNGWPWGISTQPAMWEQRQWIWFFCDFYYTTPRLSEINTCFKYSYKHSSSWINKSHTFSGGITLWKPN,SIQKLGELNIGMDGLGNEVSALNQQCNGSKGNGSNGSSVTSFTTPPQDSSQRLTHDASNIHTSTPRNPGSTNHIPFLEESPCGSQ,PFKSLVNILEWMALVMRYQHSTSNVMGAKAMDLMVLLLVLLHHPKTLVRDHMMLQIFIQALLVILDQQITYLFWRNHLVEAK

Amino Acids from 3' Exons

YTCCTEAYRQNLGPEFSFRKRACKWSTESRTSTRKK,DTPVDAQRPIGSEILGQSSVSEKEPANGAQNPGPAKQEKNE,IHLLMHRGLSAVKSWARVQFQKKSLQMEHRIQDQLNKKKM