McDonnell Genome Institute

Washington University

CircRNA

chr1|108983281|109023521|-|WDR47|ENST00000357672.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9346

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

13

Peptide

LVTQQAINMTAEETVNVK

Amino Acids from 5' Exons

CTDSAAGGTFKETSRIHLLCGLESLWAVISNRIKQIRQSAALQCRDLRN,AHETPKQPVVRFKRNKHHKGSIYCVAWSPCGQLLATGSNDKYVKVLPFNAETCNAT,HMRLLSSRWYVLKGINIIKDPFTVWPGVLVGSYQQDQMTNTSKCCPSMQRLVTQQ

Amino Acids from 3' Exons

AINMTAEETVNVKEVEIIKLILDFLNSKKLHISMLALEKESGVINGLFSDDMLFL,LSIRLKKQMKRLKSLSFWTSIQRSFTLVCWPWRRKVESMACFQMICFS,YQYDGRNSECKRGNHANFGLPEFKEASHYAGPGEGKWSHKWPVFRYAFPE