McDonnell Genome Institute

Washington University

CircRNA

chr1|108600565|108612294|+|FAM102B|ENST00000370035.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.992

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LLDQEIPLAAVYWK

Amino Acids from 5' Exons

GGGTSKLCSLEKEVLIYVQNECKCCHRHPRSLYLQSIREE,EVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRK,RWYKQTVFAGERSSHLCAKVQVLPQASILVSTEYPG

Amino Acids from 3' Exons

LGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILK,WALQITWQSLLDQEIPLAAVYWKAMIPKIQDRIIPFL,GLCRSKPGRVCWIRKYHSPLFTGRLYQKYKTGFHS