McDonnell Genome Institute

Washington University

CircRNA

chr1|10417375|10419539|+|PGD|ENST00000270776.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9284

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

10

Peptide

HEMLPASLIQALYASK

Amino Acids from 5' Exons

ALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIR,HSTLPRSSLTLKALCCGRQPPSLAGLSIMVASPCGEGAASLE,TLRFQDHLLRSRLYAAKAGSHRVWLDSQLWWHRPDVERGLHHK

Amino Acids from 3' Exons

DSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQ,TPGGGQSALGSRLAFPCPVLPLPSPSMTGTDMRCFQPASS,LLAAGSQHWGPGWHSHALFYHCPLLLRVQTDASSQPHP