McDonnell Genome Institute

Washington University

CircRNA

chr1|10411417|10417117|+|PGD|ENST00000270776.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

KVGDEGAGHFVK

Amino Acids from 5' Exons

VGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQ,WEMREQATSRWCTTGSMGTCSSVRHTTKTCWAWRRTRWP,GRGSRPLREDGAQRDRVWGHAADLGIPPDERRAGHGAGRDGP

Amino Acids from 3' Exons

EKLSLLGAYHLRMREFKLAKSRVPRSSSLMVIRNHSWRTFG,RSCLCSVLIISEGENSSQKAEGSPEVPVWEIIPGGHSE,EAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRK