McDonnell Genome Institute

Washington University

CircRNA

chr1|10404160|10411552|+|PGD|ENST00000270776.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9446

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

DVLGMAQDEMAQR

Amino Acids from 5' Exons

RRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEA,DGAETSRPREFYLWGAESVVERKGPGMAHRSCQEGTKKR,TVPRPQGQGNFICGERSQWWRGRGPVWPIAHARREQRSV

Amino Acids from 3' Exons

VGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQ,WEMREQATSRWCTTGSMGTCSSVRHTTKTCWAWRRTRWP,GRGSRPLREDGAQRDRVWGHAADLGIPPDERRAGHGAGRDGP