McDonnell Genome Institute

Washington University

CircRNA

chr1|10363282|10365648|+|KIF1B|ENST00000263934.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

ESSHWHLR

Amino Acids from 5' Exons

ESSHWHLRTQLMQNVRHRS,NRVTGIYELSLCKMSDTGSP,IESLAFTNSAYAKCQTQVVQ

Amino Acids from 3' Exons

VEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATK,WKKPATFCCCVRDLVTASPNPATRYPPASAVGPSAPPPVSPLRSQPLPLKAPSHLARAVAMIQETSKAWWTERKSWLP,GKNPPLFAAAETWQHPQIPERLVIPQPQQWDPQHLHQYLLSDLNHYLKRHHTREQWLFRRHRKPGGPRERAGYQ