McDonnell Genome Institute

Washington University

CircRNA

chr1|102886806|102923389|-|COL11A1|ENST00000353414.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9551

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

6

Peptide

DLQLSHPDFPDGSARPTW

Amino Acids from 5' Exons

GPPGEVIQPLPILSSKKTRRHTEGMQADADDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPD,VHLVKSFSLYQSCPPKKREDILKACKQMQMIIFLITRMEWKKYLVPSIPNKTLSINFQWVLRPIQPELVKTCNSAILTSQM,STWSHSAFTNLVLQKNEKTYRHASRCRYSLLGWNGRNIWFPQFPETRHAYEISNGYSDQSSPNLRPATQPSLPR

Amino Acids from 3' Exons

GLPGPPGEKGENGDVGPM,VCQAHLVKKVKMGMLVP,SARPTWKRKWGCWSH