McDonnell Genome Institute

Washington University

CircRNA

chr1|10282321|10375373|+|KIF1B|ENST00000377081.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9018

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

LAQYDLK

Amino Acids from 5' Exons

IKIFRTISIDTCPLRINALAIFPQHPWGPSLHPHLPAHSVVRWARLPVFKRGSCLHLEERKLLNV,SERFSEQAILASLESTPWPFFHSIHGVPHFIPIFLLTQSGGLDVCDQYSREDHVYTWRRGSYTFK,LKDFQNNKHRYLLASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLK

Amino Acids from 3' Exons

TPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTI,HQTPLLSAQSTVGSFCRPSMTKTTTGCMPSTHFLAQY,TKHLCCLHKAPWGPFAGPQQRHERLVVCLQPTSSWHNT