McDonnell Genome Institute

Washington University

CircRNA

chr1|10258492|10268263|+|KIF1B|ENST00000263934.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9606

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

TVCTMTLAR

Amino Acids from 5' Exons

PEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQ,PKIPVLHLKTVCTMTLARKCSYTPLRDIMSVFLPMGRLVLENLIQWVNKKKARLASFH,RRSLFCISKPCVQHWQGNALTRLGICLYFCLWADWCWKILYNDGTRRKPGWHHST

Amino Acids from 3' Exons

DSGSYKHENKPFPRCVYDCFHPEETRDQPFHE,TVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK,QWQLQTMKQVAVPTLCLRLFSPRRNTIMRPTFPLR