McDonnell Genome Institute

Washington University

CircRNA

chr1|10161141|10171329|+|UBE4B|ENST00000253251.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9462

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

RHDVFAR

Amino Acids from 5' Exons

LREAVCSLYKHVDKRHDVFARKSGVSEANPSAGRDEEQRTVGPVAP,SGKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPR,PGSSLFAITCTTRRFCSMKVWSLSESMKCRKRRTKNSGTSCP

Amino Acids from 3' Exons

ELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQ,SLDPDWLQCTLIFSNFVAPSAVTKLKTLRNTALNQRSCWTNRIFTYSWTVLGSRKPLLTT,AWTPIGCNAELSSATLWPQVPPESKPEIRLTKEAVGPTDGYLLTAGLCSVRESHCRP