McDonnell Genome Institute

Washington University

CircRNA

chr1|10130499|10145039|+|UBE4B|ENST00000253251.12

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9417

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

TQLKVASLR

Amino Acids from 5' Exons

VASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDD,LLLCGCGCRNPVLAVGGSCRDSLTGLSLASQSLQKM,CFFAVVVAEILKSWLWAGAAETLLLRGFLLLSLCRR

Amino Acids from 3' Exons

NCRRFEKKPMERFPTGNTPRNAEALNSA,TVEDLKNNESQWKDSPLATRHREMLKRCKTQLK,LKIKIMKANGKIPHWQLDTAKCSAVKLSL