McDonnell Genome Institute

Washington University

CircRNA

chr1|100724623|100734768|+|VCAM1|ENST00000294728.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9028

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

SLTLDVQVSPK

Amino Acids from 5' Exons

YHPRIQLFLIHPQSCKKVALPPVPARVYQLQRFSGVRNIMGIYSTFLEMQLSPLLGWKILEFMCVKELILGKTEKRWNLFK,ITQEYSYFCESIHKAARRWLCDHDLFQRGSTSSRDFLEEIRWESTAPFWKCNSHLNCYEDGRFWNLCVRSFDWEKQKRGGINCS,SPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQ

Amino Acids from 3' Exons

LLQKTNLQLFLLRVSKKETLSSSLVHVEMFQKHGSRKKRRQETQYNLMAPIPSERPSRMREYMNVNLKTKLAHNEVHLMFK,YSKRHKTYSFSFECQRRRHCHHLLYMWKCSRNMDNPEEKSGDRRHSTKIYRWRLYHPKGPVEGCGSIMIKQSWLTIKKFNTCS,TPKDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQ